DPCstruct | MC6905
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 177 ± 32 aa |
| Standard deviation of domain lengths | 31.64 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 91.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842P711 | 122-355 | ISENNIICTELDLERSDLHENIFSLIKKAQEDIIALYSDIDNTERIVNRLDDFFFHQLPSLGYDIFTTRVIGGERKAEAVRAIAKEK… |
| A0A843C3E9 | 1-188 | LKPDNAEALTPLFEDIFPRYLIDGMPEVKKYLDKFFFTDIPKSNFGPVFDSTIVCGGGRKRESIIEILEEHNLKASDSIAIGDSITD… |
| A0A352Z7L7 | 53-209 | None |
| A0A662PEW7 | 156-303 | None |
| A0A6I1Z6S2 | 492-655 | None |
| A0A554IBN3 | 188-350 | None |
| A0A843E6I6 | 64-293 | None |
| A0A7J3T1V7 | 17-201 | None |
| A0A2H5VIA3 | 1-131 | None |
| A0A7K4AP32 | 1-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.