DPCstruct | MC6904
Metacluster Properties and Pfam Annotations
| Number of structural domains | 276 |
|---|---|
| Mean domain length (aa) | 122 ± 19 aa |
| Standard deviation of domain lengths | 18.81 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.53 |
| Pfam Score | 99.64 |
| Assigned Pfam label(s) | CL0036- PF02310 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S2MNH3 | 258-370 | SDIGGWPESVVAPSPIAWDDNHADPRELTVEDIQRVVGAFKAAAKRAVDAGIDMIQIHCAHGYLLHSFLSPVTNKRTDSYGGSFENR… |
| A0A843BXK7 | 114-230 | EQIVGPSNIPSTLTGVIPQPMTKKMINDVTKGYVEASARLQKAGFDGVEVHAGHGYLLNQFFSPLYNDRTDEYGGSLENRTRFAVEV… |
| A0A1E3H5D7 | 83-194 | None |
| A0A3Q0FKT2 | 11-134 | None |
| A0A421JWH9 | 590-734 | None |
| A0A1T5KZP1 | 40-150 | None |
| A0A2G3CPE0 | 216-353 | None |
| J5EC50 | 1-108 | None |
| A0A1L9V5C1 | 41-181 | None |
| A9WRK2 | 24-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.