DPCstruct | MC6902
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 181 ± 27 aa |
| Standard deviation of domain lengths | 27.12 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 15.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A850LX92 | 65-221 | KIAVTDIAHQVAQEDANIIRRLLPYLYVIYNKTEAYLTRASPDPVLIMNTANVLTLAKSVLYDEVASLKQKIIDVANQISKEYKTVN… |
| A0A843BUF3 | 5-184 | RNSATTGNFWTIAIGIMLLAWGTVCLVFWVAFNNPSIPGSPWLMLPGGIMIVAAISNIITYRYNREKILGALQSYERVSIEQLSSEL… |
| A0A369M576 | 13-210 | None |
| A0A1I2N7P8 | 29-220 | None |
| A0A6B8RC04 | 28-229 | None |
| A0A2S8PCB0 | 7-194 | None |
| A0A511TIP7 | 27-203 | None |
| A0A1T4QKP9 | 76-266 | None |
| A0A239RHU7 | 5-185 | None |
| A0A264DGD9 | 245-451 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.