DPCstruct | MC690
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 82 ± 6 aa |
| Standard deviation of domain lengths | 6.12 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0014 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7B3B3 | 154-234 | LSSSRVHGYEYLECARDDINNLFRKANVSTILFIPYALKNQDKYFNMVEPVLSKWGYVVNGIHKGDPKTLVKQAQAIFIGG |
| A0A315VYM3 | 1-89 | MKRRLLLVSNSTLHGSGYLDHCQQHISSFFGKNVKRVLFVPYALHDRDAYTTTARNKFRSLGYEVDGIHEAADPVEAVRKAEGIFIG… |
| A0A1A9X544 | 464-539 | None |
| A0A7R9DIQ5 | 38-125 | None |
| A0A2J7PKG0 | 11-83 | None |
| K1PWS2 | 1-86 | None |
| A0A1F9VFK1 | 3-89 | None |
| A0A1Z4KUM4 | 1-90 | None |
| A0A7R8VEF9 | 11-92 | None |
| A0A3B9Q8D0 | 42-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.