DPCstruct | MC69
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 151 ± 18 aa |
| Standard deviation of domain lengths | 18.03 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X0S3E0 | 1-155 | MKTNKDEIFKFIEDSVDANKKGLSAGEIAKKLNLQRSNVSSILNELHRDGLLLKIKGKPVIYTLDSTIKSQGALIKENANFNMLIGN… |
| X5NXX3 | 12-168 | RIDNIHQALKQFHVQNPSSKETLLPATASQLSQTSGYTRTAVSEELSELVRKDQVVKVKSRPVLFFDKDYLEEQFPFFKSSTCYDSL… |
| A0A6X9J5M3 | 1-182 | None |
| A0A0H3GJQ0 | 1-141 | None |
| A0A2I8QIT8 | 3-130 | None |
| A0A381I760 | 5-173 | None |
| A0A412J121 | 7-129 | None |
| A0A416G0U3 | 1-179 | None |
| A0A1I2BDR4 | 9-167 | None |
| A0A7U9MMD8 | 23-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.