DPCstruct | MC6898
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 244 ± 47 aa |
| Standard deviation of domain lengths | 46.81 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.40 |
| Mean intra-cluster sequence similarity (%) | 13.51 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0236- PF09556 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A353L0C8 | 1-142 | MWDIPKNIISILKRYTGEEKPTVKSPKDVRRMFANEFTEDEQTSILKWLKKNQSLIVSDILKGRGKFVAEWMLVAQKEIKNARWILK… |
| A0A842R8F8 | 42-277 | QKWLSFICKQNKQNYDNLSSVKVEKIAGRHKADILVQLIFKNNSILDAKISLKRQKGERGYNHIHRENAAEFAERFNFSPVAKIALL… |
| A0A7X2JJ00 | 46-317 | None |
| A0A2G9N8V2 | 2-165 | None |
| F8KQQ0 | 1-177 | None |
| A0A7U9R2V3 | 138-438 | None |
| A0A3R7WLT9 | 158-442 | None |
| A0A412LDE3 | 8-192 | None |
| A0A1A9VK08 | 255-495 | None |
| A0A843FT56 | 22-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.