DPCstruct | MC6896
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 94 ± 13 aa |
| Standard deviation of domain lengths | 13.40 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 23.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20068 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A202E920 | 16-93 | DEIELLEREFDGSPAQAATWLRELAETLEAGGELTVYDDDESVTVSLPDEELEFEVELEREPSDDGDELELEIELEWL |
| A0A842R7P0 | 1-88 | MENVLLKSEEKKSRSDIVAFLKEIAVKIDSGTVKLVQGEQSLELVIPENLTFELKVEEKLKPNRPRKMQLEIELEWSEGEPSESVQLG |
| A0A2N6PIC1 | 1-99 | None |
| U1NTU1 | 2-81 | None |
| A0A7C2PYI0 | 15-113 | None |
| A0A0C1Z8T5 | 1-81 | None |
| A0A7J0BVV3 | 2-87 | None |
| A0A2M8B7F6 | 20-103 | None |
| A0A1H1CGP0 | 219-310 | None |
| A0A832BYG3 | 95-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.