DPCstruct | MC6895
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 98 ± 12 aa |
| Standard deviation of domain lengths | 11.87 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 27.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11259 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X1TB03 | 69-155 | HGNLTMINNGAKDTIDCNDGNLRLDGDNNTYTVTGHCRRLDIFGSANHVVVDSADTIGAFGDDNAVIYHSGSPTINKTGNNNTVWRG |
| A0A0H3LCZ7 | 1-102 | MTTGESTTASIQIGDMLTYGSIGTTATLDCADGKSLNVAGSDNTLTVNGTCETVTVGGANNKIAFDRIDERLVVVGLDNTVTYKNGD… |
| A0A535E594 | 24-140 | None |
| A0A520BNZ9 | 23-134 | None |
| A0A1J0U6Y8 | 209-295 | None |
| A0A543ATC2 | 19-125 | None |
| A0A2N8LJU4 | 236-320 | None |
| A0A7I7QDI9 | 5-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.