DPCstruct | MC6894
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 259 ± 46 aa |
| Standard deviation of domain lengths | 46.47 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.83 |
| Pfam Score | 84.94 |
| Assigned Pfam label(s) | CL0067- PF04998- PF05000 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A149V9A9 | 71-251 | GEIIEQPIIANFKEGLSVLDYFTSSHGARKGLADTALKTANSGYLTRRLVDVAQDCIIVEPDCGTERGLTVRAVMDSGEVVASLSER… |
| A0A2G2WJC4 | 117-356 | MRGLMSDPQGQMIDLPIQSNLREGLSLTEYITSCYRARKGVVDTAVRTSDAGYLTRILVEVVQHIVVHRTDCGIAPGIFVSPRNGMM… |
| A0A396I5W7 | 19-265 | None |
| A0A1Y4CZ42 | 282-585 | None |
| A0A4S4E972 | 2-257 | None |
| A0A0G1K9N5 | 211-545 | None |
| A0A1V3WKY8 | 232-536 | None |
| A0A059ADJ1 | 2-229 | None |
| F3KFL6 | 101-275 | None |
| Q20EX3 | 199-509 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.