DPCstruct | MC6893
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 91 ± 15 aa |
| Standard deviation of domain lengths | 15.20 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 42.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833UGM0 | 112-191 | DKALLANAAKLETMRSLWMSSCSVTFGACKLLGQKMPRLNVEVIDERGPPDSRPERCPIEKLYIYRTVAGPRFDMPGFVW |
| A0A2G2WH63 | 78-169 | LANAAKLETMRSLWMSNYSVSFEACKLLSPKLPGFNVEFIDERGHLDTRPESCPDEKLHIYRKVSGRRLDTPNFVWIIKQDVSLTPY… |
| A0A830DQ52 | 19-96 | None |
| A0A699GK23 | 445-552 | None |
| A0A7J6W5U8 | 283-374 | None |
| A0A816PLS1 | 1-68 | None |
| A0A0A9UAT8 | 25-121 | None |
| A0A3S3RAX3 | 223-300 | None |
| I3SMD0 | 1-69 | None |
| A0A1U8FFZ7 | 90-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.