DPCstruct | MC6892
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 56 ± 2 aa |
| Standard deviation of domain lengths | 1.80 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 92.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.13 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 71.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6W5U8 | 260-314 | MLSVAFAGDSDKGMIYVLNGCKNLRKLEIRDSPFGNGALLEDVGKYETMRSLWMS |
| A0A833UGM0 | 77-131 | MLSVAFAGESDLGLHHVLSGCENLRKLEIRDCPFGDKALLANAAKLETMRSLWMS |
| A0A2G3C4B5 | 1-58 | None |
| A0A6A3CJG1 | 1-59 | None |
| A0A0A9UAT8 | 1-55 | None |
| A0A438HZ52 | 51-103 | None |
| A0A427AF18 | 228-282 | None |
| A0A1D6J601 | 77-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.