DPCstruct | MC6891
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 106 ± 22 aa |
| Standard deviation of domain lengths | 22.02 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 78.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 43.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G2WCV7 | 1-96 | MDDGINAVVLMDYVEFQIFPSHNRSHVCYGNKIETAASGLLEQLIIHSPKIISLHSKGSDVDFRFRPVRNLSDAKWFTKSTLIRIID… |
| A0A446UYY9 | 2-107 | RPETRLDSAAFQLTPTRTRCDLIVIANGRKEKIASGLLNPFVAHLKAAQDQIAKGGYTILLEPDPAADAPWFTRGTLERFVRFVSTP… |
| A0A2J6JHE5 | 65-134 | None |
| A0A0B0PW34 | 18-136 | None |
| A0A164WZB6 | 1-116 | None |
| A0A5N6PMG7 | 58-178 | None |
| A0A835IP67 | 2-119 | None |
| A0A7J7P8X2 | 3-135 | None |
| C6JS63 | 2-112 | None |
| A0A314YUF7 | 2-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.