DPCstruct | MC6890
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 148 ± 23 aa |
| Standard deviation of domain lengths | 22.88 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 48.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06521 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9T8R7 | 1-112 | GNLECEDLPIEYCAFSVASSGTRCVLEKYRGKDGIILYECQSSMTMAEREEEWIESDECIISCGMERISVGLSTDLLMDSHFTKMLC… |
| A0A2G2W816 | 10-174 | SLFLRGALGDLICEELPVEMCTLSIASDGKRCVLESRPSDEGNLECQTSEVYASNKMLMEYIETNECVGACGVDRQSLGLSSDNLLD… |
| A0A2K1J027 | 14-183 | None |
| A0A4S8IAW9 | 25-157 | None |
| A0A059A6Q1 | 98-256 | None |
| A0A0K9RNG3 | 28-185 | None |
| A0A5A7PJ41 | 7-225 | None |
| A0A314Z3H8 | 1-133 | None |
| A0A834LK42 | 161-318 | None |
| A0A0A0L6J6 | 2-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.