DPCstruct | MC689
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 310 ± 39 aa |
| Standard deviation of domain lengths | 38.59 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8IU70 | 5-276 | PNEPVSDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPAFGECVGIASKALCGLTEAAAQAAYLVGISDPNSQAGHQGLVDPIQ… |
| A0A315VQJ4 | 25-361 | SMNSSSGRSTCQGSSSPLSGSVQQRKRLSFICDACKAKVQMVADLLLLSSETRPVMTSEGVALADTFDQCRDTVIARTKELSILTHD… |
| A0A183LSE6 | 2-382 | None |
| A0A0K0EJV8 | 1399-1693 | None |
| A0A183W1J9 | 20-309 | None |
| A0A5K4FAM0 | 1546-1866 | None |
| A0A183KPX6 | 3-380 | None |
| A0A1S3PX09 | 490-782 | None |
| A0A182EID8 | 566-859 | None |
| H2NP07 | 26-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.