DPCstruct | MC6889
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 198 ± 19 aa |
| Standard deviation of domain lengths | 18.93 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 65.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 47.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6P797 | 15-169 | SLNIKGQSGLITPQEQNHKKKEVENDDLTVTSSVRFVNERWKQGNWDLNMFVKSGKMDWYALIVDEARRRKFLELHPEEATNQEPVL… |
| A0A2G2VQR2 | 1-213 | MTPKVEEQTHLNVVEIKDRSNLLIDDNAKPTRNSDEVQGDTSSCESQDLRFSDERWKNGTWDLNMFVKNGKMDWDAVIVAEAKRRKF… |
| A0A0B0N1D6 | 278-475 | None |
| A0A5A7TG76 | 74-267 | None |
| A0A816MX74 | 70-262 | None |
| A0A328DY69 | 47-238 | None |
| A0A7S2X9E7 | 1-229 | None |
| A0A2K1JH07 | 85-289 | None |
| A9NXM6 | 156-361 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.