DPCstruct | MC6887
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 168 ± 9 aa |
| Standard deviation of domain lengths | 8.94 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 30.14 |
| Pfam Score | 85.00 |
| Assigned Pfam label(s) | PF04597- PF14966 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444SZU4 | 67-238 | LQEPLLVVIAFFLMFLLVILYVRLDLTLSKDETTEAKMRVSSHCEMVHSHHDKRASLYEKLEEEIQKLKTTKDISHSQLPTKKIFSS… |
| A0A498SVK3 | 1-146 | MHFEDIATESRLQAQGQVEQLTDLHADRLKIYDHFVDAVNKFKNTKDLAAFATARKKAENDLKNIGQAIGDLQSELKSTNADISDKL… |
| A0A3P7IX24 | 1-168 | None |
| A0A224Z5H1 | 1-173 | None |
| A0A095BZG3 | 206-377 | None |
| A0A267GH44 | 74-250 | None |
| A0A0V1NNN0 | 430-590 | None |
| A0A0R3W943 | 1057-1229 | None |
| A0A4S2KVT4 | 245-417 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.