DPCstruct | MC6886
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 276 ± 37 aa |
| Standard deviation of domain lengths | 36.69 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 72.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.65 |
| Pfam Score | 87.04 |
| Assigned Pfam label(s) | PF06400- PF06401 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7A785 | 366-670 | KLNSLWTKAQMRLSEAKLKSLFGELKLQDKEEVTWKKLKSEGRDKEGLKESELRKKLLHILELYGLLEHFEDMIPKKRSEHKMFNEV… |
| A0A498S8G2 | 3-284 | FDAIISSLMRFFHPFANSHCVFVDELDKFDSLYLSAKARSIKNEKLVLEEVDNKLVQLLEKYGLESAVDAYMKKYKWRNEEQNENTI… |
| A0A212F912 | 16-249 | None |
| A0A182SZY4 | 1-200 | None |
| W5PV43 | 50-341 | None |
| A0A2H2I173 | 4-270 | None |
| A0A6L5DGC7 | 19-215 | None |
| A0A1I8CZZ6 | 20-310 | None |
| F1PAG7 | 60-349 | None |
| A0A0N4U4H6 | 12-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.