DPCstruct | MC6884
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 155 ± 16 aa |
| Standard deviation of domain lengths | 15.74 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y4XZ42 | 77-233 | SQFTTDEINQLVCFNQRLSNLEAYLCDLGAKESGHLKACVADPNDPLDDYEIDATLYYILDENDPTFDEDDDNILTQREISIKCSNR… |
| A0A7H1DZR7 | 1-150 | MLQITAEELNKFSNLNDKVRKVEVRAKDYLLQLEPLLQKQKNEGLIDDFEIVPRVSVFSYDEDYCKSENIELGDEIITEKEISYMLF… |
| W0IYV1 | 69-227 | None |
| A0A1W1CZ61 | 1-156 | None |
| A0A7S9S9Y8 | 2-133 | None |
| A0A368UYJ3 | 205-365 | None |
| F5YKL8 | 72-233 | None |
| A0A1A9KEP9 | 5-168 | None |
| A0A7K1SVB0 | 27-165 | None |
| A0A7C8AVR8 | 92-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.