DPCstruct | MC6883
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 207 ± 38 aa |
| Standard deviation of domain lengths | 37.54 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 29.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1K9M6 | 2-205 | STIRSLLAREPEREIVGVIKVDDHDPARVWTELDEYVATEEIKGYFRTFVDRFIESRRGLGEDLCVWISGFFGSGKSHFLKALGYLL… |
| A0A7H1DV91 | 1-202 | MIIKNFFEKDINRNIETVIKADDRDHISTEVAEYVITKEIGNKIRELFSNYKSYSGSNGVWISGFFGSGKSHLLKILSYVLENKEVD… |
| A0A7W3Z7N0 | 1-213 | None |
| A0A258X1E2 | 1-118 | None |
| A0A5Q4H8J9 | 1-206 | None |
| A0A1U7MPL4 | 1-295 | None |
| A0A1V5QUM8 | 1-219 | None |
| A0A1V1PBJ6 | 1-225 | None |
| A0A6L5X673 | 1-204 | None |
| A0A370AKV9 | 7-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.