DPCstruct | MC688
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 86 ± 10 aa |
| Standard deviation of domain lengths | 9.64 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 68.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 46.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9HUR0 | 50-121 | KVFEDRSVGIVCYKDENGEITCEGYDEGPRLYHQLSRFCYNTRDAEIIEILERCWLQVADENEFSNGDKGVA |
| A0A067KWU6 | 3-80 | FENKSEGIICYRDDSGEIICEGFDEGPRFHHHLPRTAYNSRDAEIINLLQQRLIHVVNGGEFDNSDNGVITVKEDFNF |
| A0A7J7LAZ5 | 45-128 | None |
| A0A835BRM2 | 35-139 | None |
| A0A6P4AVG1 | 98-184 | None |
| A0A7J9J8M0 | 25-104 | None |
| A0A5C7IGL7 | 54-148 | None |
| A0A5N6QIJ6 | 28-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.