DPCstruct | MC6878
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 177 ± 17 aa |
| Standard deviation of domain lengths | 16.98 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D0Q909 | 191-357 | SQSAGRLANYYNAVQPLANVLDAVVLHGGGGVLRTDLPTPVFRVNSEGDVSGGILPAAARAQADSAILRSWEVAGASHGDWKLIRDY… |
| A0A3D0QY28 | 1-212 | MTESVPYVNNILVRRPAKQSDSVYLNTYATNFHEKVTEANRGPVFDGYLNTVGPVIERPLRQAEEGGFVTVPGSEPALDVPFISVTS… |
| A0A847ENR9 | 3-170 | None |
| A0A6I4MDM5 | 720-897 | None |
| A0A7Y2EMC6 | 16-198 | None |
| A0A534PV80 | 202-354 | None |
| A0A076N5K3 | 1-201 | None |
| A0A4Q7U082 | 234-394 | None |
| A0A534VYG9 | 888-1070 | None |
| A0A7T4NA00 | 220-395 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.