DPCstruct | MC6877
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 156 ± 32 aa |
| Standard deviation of domain lengths | 31.52 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 19.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07799 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W6NI04 | 1-117 | MKQGAMFDSERKYRYLLTREWDITRPKLLYIMLNPSTANESSEDQTSRQCLFFANKFQYGSLEVVNLYSLRSTDPKRLKESLIDPVG… |
| A0A2K4FB65 | 7-160 | TIYTEAIFSKDKKHRYLLKKTWDEKKPACTVITMYPHLDGVLSLDLTTVLILNQLANSEQYGAVYLVNLFSNIKTPMSIKHLKDKEP… |
| A0A7U7KM58 | 141-307 | None |
| A0A7Y6BVU3 | 2-163 | None |
| W0EXE0 | 2-132 | None |
| A0A1G5ASB0 | 8-189 | None |
| G6C509 | 240-397 | None |
| D7BMW6 | 16-226 | None |
| A0A1H5HI15 | 19-195 | None |
| A0A0V0QXF1 | 2-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.