DPCstruct | MC6874
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 209 ± 16 aa |
| Standard deviation of domain lengths | 15.84 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I4IBT2 | 4-218 | ITKLCADSLRSFSLNKFNISIKSSHAHELVAAYFGYSSRAALLADDKRPIRKLTDAEFIVLTPTAHIKERRKNLNGLPPNLPDDLAE… |
| A0A3N6MT25 | 1-216 | MVTLRKIAFAVRNASNRAGYPIKLNHADQLVAAALGHASLAAFQASDAKTGSLDAAAHLVLDVDLLTARCGQLDPRYEPEIVASFVR… |
| A0A7Y4BGK6 | 232-442 | None |
| A0A1H6ZKW6 | 5-215 | None |
| A0A377ZZT8 | 1-199 | None |
| F8LCT0 | 5-212 | None |
| A0A4Q4XEX5 | 22-244 | None |
| A0A4Q6EAN4 | 6-213 | None |
| A0A4Q7I616 | 1-249 | None |
| A0A3N7CQ24 | 2-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.