DPCstruct | MC6873
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 199 ± 26 aa |
| Standard deviation of domain lengths | 25.74 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 71.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.28 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 26.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0VSY1 | 8-188 | YCAGCHGSDFRGGDVGVSCYTCHNGPSGHPAEGWLVKTSESFHGLAASDRGLASCAACHGEDYEGGISGTSCKTCHTSQSGHPSEGW… |
| A0A1G0M7N5 | 19-217 | ISGCGDKNPQANFNADSGQHLAGWDLAHKTAGTTDLESCFECHGDSLEGGISKVSCTQCHLGSAGAVHPLNWGQYAYARHKAFVNAE… |
| A0A6H9LA25 | 1-227 | None |
| A0A3A4WJD9 | 25-223 | None |
| A0A143BAC1 | 1-242 | None |
| A0A4P5VZS0 | 97-247 | None |
| A0A1F6H342 | 48-240 | None |
| A0A1F9H0Z6 | 2-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.