DPCstruct | MC6872
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 442 ± 55 aa |
| Standard deviation of domain lengths | 54.53 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 21.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5NHL9 | 43-491 | AGAWALNATRWTDQDEQVYSDFVARLGESGHPNLNRFIRDSRQNPLYGSEDQKFNLSPDCADFPYLVRAYVAYKLRLPFGYVCEITK… |
| A0A849WIX4 | 23-427 | VFLLVVFSLSKVSASVWALNSNAVGYSNSKNTEKMEWNNEWEKHYSFWVQKVLQTNWLQNERLQYGEFNPFYRWQVDCAKLAYLTRL… |
| A0A2K9NW17 | 95-469 | None |
| A0A521TN94 | 76-538 | None |
| A0A2E4Y5Y3 | 1-358 | None |
| A0A1V5YYR5 | 8-584 | None |
| A0A1I1V821 | 515-973 | None |
| A0A7X7VDH4 | 31-457 | None |
| A0A1F3VAW4 | 89-465 | None |
| A0A2M8B6P2 | 630-1080 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.