DPCstruct | MC6871
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 213 ± 25 aa |
| Standard deviation of domain lengths | 24.73 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 28.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11227 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A3NZ82 | 109-335 | IDWSAPWLAPLADRGERWTHAAQRGEAAWLRMLNDEARAERLATGRGLPLRFIAQAALPAGIAYETHIAETGAVPTRHNLHDFFNAL… |
| A0A2E8HVB7 | 48-234 | SVLSEKAQSLLLSKSFPGVEAWNHALDSCEVTKKFYFRKQEYLGQRKRRALKKKYGLSPLGFYLKSIVVDQCIWHREQNWHDFFNGL… |
| A0A6A5KYT6 | 331-550 | None |
| A0A848QIL3 | 22-203 | None |
| D2V6T9 | 99-297 | None |
| A0A536ZUR6 | 4-222 | None |
| A0A833JHS7 | 20-233 | None |
| A0A1W9QI66 | 20-255 | None |
| A6GR09 | 7-193 | None |
| A0A521UI47 | 8-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.