DPCstruct | MC6870
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 136 ± 12 aa |
| Standard deviation of domain lengths | 11.89 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H0VBU2 | 5-140 | KNILPIMALTAFILNLIWEILHSKLYFVSGGSMPWFYLWFGTVIDVVYVLALYFIVALLLSDKAWIFKLNFKRLILMGFLGVLLAIV… |
| A0A1G2I7C0 | 2-125 | VKTLIKILIVAVVLNLIYELLHSRLYKTCLEASFKKYWFLMIKACIFDGIAITIIYYFSQLFPDYLKLIIFSVATLAFAYFWELHSI… |
| A0A2T5Y9P3 | 11-130 | None |
| A0A2N3B9I4 | 15-152 | None |
| A0A534PXZ8 | 11-152 | None |
| A0A1W9IUU1 | 25-168 | None |
| A0A7V3BID2 | 14-161 | None |
| A0A2M9DF21 | 142-256 | None |
| A0A3D5STS1 | 4-150 | None |
| A0A6N6T0S0 | 2-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.