DPCstruct | MC687
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 126 ± 15 aa |
| Standard deviation of domain lengths | 15.25 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.20 |
| Pfam Score | 97.83 |
| Assigned Pfam label(s) | CL0110- PF13943 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R0FL96 | 68-161 | HGETLLSVWPPSQQSREYGVNWMIDTLSKDSFLTKRYGKFKPEEASAVAKSIEEESYVVASKVVSAYGIKNLDVYGTEIGDRINQCA… |
| I1M8R6 | 4-123 | TETTLEQPSTPPQPDPSAAVSFSIWPPTQRTRDAVVNRLIETLSAPSVLSKRYGTLSSDESSSAARQIEDEAFSAASSSDGIETLQV… |
| A0A2T7EY68 | 18-166 | None |
| B9GNS6 | 10-153 | None |
| Q2HRI7 | 1-131 | None |
| A0A2P5Y0I5 | 5-116 | None |
| A0A804Q8B0 | 107-239 | None |
| A0A4S8JD93 | 5-135 | None |
| Q0WQ91 | 31-135 | None |
| A0A804QI09 | 1-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.