DPCstruct | MC6869
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 100 ± 14 aa |
| Standard deviation of domain lengths | 13.51 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18417 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A317C111 | 519-608 | VPAYWPARVPNQVLTKAEYKTLCDKSLTTEERTAAFYQRASWDRQLPKDQPAPEQMQYVIDHFGELGIVEAMPRPTDYELSWLPDVI… |
| A0A2R4WUZ2 | 1-128 | MPTFWPARVPNQVLTREDYDIVRDERRPLAERTAAFARRADWDAPLDLAASYTSQINTMIAHCDKMGVVESRPGPADGAFPTVMEVQ… |
| A0A1Y5S4G9 | 836-930 | None |
| A0A4Q1B4H8 | 96-203 | None |
| A0A1U9VG20 | 65-158 | None |
| A0A4Q1FNN0 | 434-532 | None |
| A0A6J7ECX7 | 523-614 | None |
| A0A375A8X7 | 95-185 | None |
| A0A6J7F4C1 | 1-124 | None |
| A0A7K2YQA3 | 213-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.