DPCstruct | MC6868
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 127 ± 17 aa |
| Standard deviation of domain lengths | 16.73 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q8HQJ1 | 1-116 | MSNHVQLLADIIITAAEGGVNYWGHVSNYHCQGDPADYRFTIRDREDPQSTPTTVTLATVEEGICRILDGTGKVNSRITEAVSYSCA… |
| A0A2R4WGG8 | 1-126 | MSAFTTTVSIPLDKVVSQIITAVEGGITYWASTFHHVSSEHEPKERPWYADQTLYEGAFDIKVLIHEEHKAGEGIEYHLTREKLQSG… |
| B0PE78 | 1-119 | None |
| A0A5M8P335 | 1-132 | None |
| A0A843HI58 | 7-173 | None |
| A0A0C6FXM7 | 93-212 | None |
| A0A3S4ZHE8 | 118-248 | None |
| A0A0G3WFN3 | 118-251 | None |
| A0A3D5E863 | 3-150 | None |
| A0A1R0WCG7 | 5-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.