DPCstruct | MC6867
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 436 ± 38 aa |
| Standard deviation of domain lengths | 37.59 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 70.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 26.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A442YX10 | 51-435 | DRFGGQVPSQSSFGIPEDIENAEELARECAQRVGIDVAAFSGCVGQQIILPEKQQEVLECAANSTRAEDFAECAAPKFGINIPDDQK… |
| A0A3D9YVV3 | 124-514 | CPFIRDTADGRAALDVLLAQQGLTPASNLSIDARNLPNLPPPSAIDSCNTSGTTQQGFIGCIKNAMGAPREKLLDCVRNSRSDEDRA… |
| A0A4R5QB44 | 9-457 | None |
| A0A4R5U9E6 | 148-688 | None |
| A0A839EQL6 | 404-872 | None |
| A0A6B9GEJ0 | 11-444 | None |
| A0A1G5UKP7 | 67-526 | None |
| H4FAG9 | 577-997 | None |
| A0A7S7QMS3 | 245-653 | None |
| A0A7T8BYB1 | 212-614 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.