DPCstruct | MC6866
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 70 ± 2 aa |
| Standard deviation of domain lengths | 2.47 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 81.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 40.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V9TAU2 | 1-68 | MKESFQGKTVWDGIVEVFDLKGHPTAFRIYAWAHDTDDPDNPRRHVTVLHAHPIKSPQDAVKAAIIQE |
| A0A442XTN4 | 1-72 | MEPVSEEFAGERVWEGLVHVFDVQGHPKAKQAFAWSSPIEESTKRRFFAVLNIPPINTPIDAVRAAIVAAHR |
| A0A7V2V315 | 43-109 | None |
| A0A2V6JF59 | 26-94 | None |
| A0A7C9GD80 | 82-149 | None |
| A0A2T6CQI0 | 98-171 | None |
| A0A6J4Y0S3 | 48-117 | None |
| A0A6G6K0V6 | 33-106 | None |
| A0A2V9DCW2 | 48-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.