DPCstruct | MC6864
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 161 ± 22 aa |
| Standard deviation of domain lengths | 21.97 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y6ZXW7 | 11-168 | PVAFSSYYYLSQWAQKIGDIKIEKLNSSRAVRVYGWVKSSGGSWWYDQVWVDKNYSSYRSAMLRHVMLHDGFTRPAMNDIDADHLAA… |
| A0A508SWE3 | 5-155 | LPGNIPVAAESFEALLKLGDPWPLGHQAQALVLVTKNASDPCMVWASPKLGTYRAIWTKASASGFVEAADEWGDNVDIDHVFPQSWA… |
| A0A3N2EJT0 | 30-209 | None |
| A0A840Y258 | 12-182 | None |
| A0A554GIA6 | 9-164 | None |
| A0A1H6ULX0 | 19-133 | None |
| A0A7W6PRL5 | 14-156 | None |
| A0A1H2GRN4 | 35-219 | None |
| A0A4R3ZSR8 | 14-195 | None |
| A0A510IXK7 | 18-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.