DPCstruct | MC6862
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 82 ± 10 aa |
| Standard deviation of domain lengths | 10.32 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 63.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M8SYE3 | 11-92 | VRPHGEKELRQPEKNFYIIGSKSYGRAPTFLLATDYEQARSVVAYINGDHESAQQVKLKLPETGVCKLTPKPPAAKTSCCCD |
| A0A4Y3RKH3 | 2-80 | GELSHPEKDVYLVGMKSYGRAPTFLAMTGYEQVRSIAAALAGDREAAERVELALPETGVCGGAGLFDEPEAAEESGGSC |
| A0A7Y9MJ62 | 1-71 | None |
| A0A7J9ZV59 | 107-188 | None |
| A0A4V2NJT7 | 357-432 | None |
| A0A0K2RP98 | 1-77 | None |
| X6D762 | 30-93 | None |
| A0A520G9K1 | 193-283 | None |
| A0A0P7JYE8 | 31-118 | None |
| A0A560AF93 | 250-328 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.