DPCstruct | MC6861
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 368 ± 94 aa |
| Standard deviation of domain lengths | 93.95 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 76.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.86 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF13111- PF18157 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A7KG93 | 52-354 | FSLPEGATLATPPLHVLVWQPQAAEALGRVGVLLRHTLLKSGALPTRSLAALAELYVPGLQRVEARMGTGYGDQKGELAWSNEPDRN… |
| A0A4Y3RBU2 | 1-302 | MPAYRSTQATVLTFTPEATWPVTGYRTTCPPGMLALLEKAWDTRPGRRPRGGPDYLPTKSLRDLLTLIDPDITSVQTNPRDPAWLRA… |
| A0A0M4TYM3 | 37-470 | None |
| A0A6P0TUI8 | 1-444 | None |
| A0A5M3XN80 | 319-677 | None |
| A0A838RLB1 | 1-434 | None |
| A0A1Z3HP94 | 1-292 | None |
| A0A1I3TRG6 | 3-268 | None |
| A0A7W5CEJ5 | 9-441 | None |
| A0A1W5XUQ3 | 1-540 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.