DPCstruct | MC6860
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 101 ± 7 aa |
| Standard deviation of domain lengths | 7.19 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 71.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 39.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11829 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U0EB66 | 4-100 | PPFLTSIVGWLRAGYPNGVPEQDYIPLFALLTRRLSEAEVDAVADALIEDGDLPIEKTDIQVLITKITNEMPLETDVDRVRNHLADG… |
| A0A7W3IUI3 | 16-117 | PSVFGRVLGWLTAGYPEGIPPQDRFAVVALLKRRLTDEQVHEIVAELTLAERPSGPDGVITDVEIEQLTERVLSEQPSPSDLARVSA… |
| A0A419ZK08 | 1-102 | None |
| A0A5C5BEJ9 | 1-110 | None |
| A0A7K0CXP6 | 65-170 | None |
| A0A7Z0DGP5 | 2-103 | None |
| A0A1Y0BZA4 | 1-90 | None |
| A0A1A2GDT8 | 14-132 | None |
| A0A1A2XE32 | 216-308 | None |
| A0A2P8GU10 | 126-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.