DPCstruct | MC686
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 173 ± 15 aa |
| Standard deviation of domain lengths | 14.88 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.17 |
| Pfam Score | 98.48 |
| Assigned Pfam label(s) | CL0482- PF06749 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L6T2E7 | 6-181 | TTIIVCSVVGSLGVLSSILGFSAEGTKLTPNDILVLGDECIYPQNPALGLGICATIFLLAAQITVTAVGGSCGCCKSRAIPSETKRI… |
| I1LET5 | 7-184 | ILVLIIALHLIAFVFAVGAERRRSEAKVVPDEYDDQTFCHYTTDASTVYGLSAVALLLLSHTVLNGVTRCLCCGKGLVSGCSATSAV… |
| A0A5B6V5H1 | 5-181 | None |
| A0A835S9H4 | 195-377 | None |
| A0A835JBX1 | 2-173 | None |
| A0A6J1EX08 | 72-233 | None |
| A0A0E0HEZ1 | 1-175 | None |
| A0A843UD42 | 6-208 | None |
| A0A2G5DKK9 | 4-177 | None |
| A0A803LWC0 | 2-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.