DPCstruct | MC6859
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 223 ± 29 aa |
| Standard deviation of domain lengths | 28.52 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 29.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q3NUU9 | 291-475 | YGHHGELAMFYRVEQHTQSRGSSYPAYRSKDGLGAPYYNTVKTRLPERPNLYLVQSFDKKKSEKSEQSQLNFIAGLDPKTLEQRFPQ… |
| A0A077PEG9 | 21-274 | VFTGSGVKALTSLNHFRHVNDADSVTSVPFDTNMDNWLFEVYGPLGTIFGFSWTLATLPTIPIQKSLPEIGEVYYHQGNTVSFFQAR… |
| A0A2V5AKP7 | 12-219 | None |
| A0A5E6XP14 | 173-425 | None |
| A0A2X5NLL9 | 14-196 | None |
| A0A7H9FWW8 | 2-207 | None |
| A0A140NPN9 | 388-640 | None |
| A0A1G5RAQ8 | 2-241 | None |
| A0A376L2K0 | 43-240 | None |
| A0A4R7Q2T5 | 116-368 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.