DPCstruct | MC6857
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 313 ± 31 aa |
| Standard deviation of domain lengths | 30.73 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 25.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q5L5N4 | 178-467 | LIEGLNQGNSIDSYPNHLKIKLQNFSFPNLQSTCVHAGLLPLDDVLLKECPFYFINRLIARGDRKFPESQGLSPEVYWTNRRGFASC… |
| A0A656IQ82 | 7-289 | LGRFTQKLKIALNKHGISEFVDSLEQIDLASLDLVLIQHCPLYWLRKFIQSASEIPERDFITGASYEEIASYWLGTSGCCHNAGTIF… |
| S7J515 | 151-433 | None |
| A0A173DXT4 | 92-360 | None |
| S7K3D9 | 82-423 | None |
| S7JWX3 | 3-265 | None |
| Q822P0 | 224-555 | None |
| A0A0E2IZW0 | 33-351 | None |
| S7K307 | 2-317 | None |
| S7IV56 | 90-440 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.