DPCstruct | MC6856
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 149 ± 14 aa |
| Standard deviation of domain lengths | 14.13 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 25.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02467 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G5FIC1 | 6-148 | RAPCEKVSWHVDPSPETIDDAIEMCRGCFMLRECARRALVAGSSLDGSWIHPANGVVQAGVLCTDDMQTAEALAEIAGMEVPAYRDK… |
| A0A6G9Y0S3 | 96-245 | DWRHRALCRDQPPERWSTDLLPKGHELREAAAAQRCAGCDVIAACAKFHLRRRATVGMVVAGIAVGGRNCTPASDTRRLEAVAAGRP… |
| A0A6J4W510 | 6-175 | None |
| A0A4V1BGK4 | 10-189 | None |
| A0A097IDF8 | 11-160 | None |
| A0A2S9Z393 | 7-136 | None |
| A0A164K2F1 | 7-139 | None |
| A0A4Y4C5S0 | 24-177 | None |
| A0A540R9P0 | 1-163 | None |
| A0A1H1LQN7 | 2-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.