DPCstruct | MC6855
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 97 ± 15 aa |
| Standard deviation of domain lengths | 15.25 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 67.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7L8CZR5 | 7-104 | AAAAEAAAMATRDAATMPPTPVLPSPAAAGMTDTSQVTVTSSEPDSIVGDYSIDFAAMDTNHNDNISRAEARTNPTLTAEFAAVDND… |
| A0A1F4FLU0 | 15-80 | ALLAAMPFATLSAAARSAATPAFERVDRNKDGFIDPREAQGVPGLAESFARMDANRDGKLDRVEFA |
| A0A2S6Z6B4 | 15-117 | None |
| A0A4Q3VC61 | 1-83 | None |
| A0A522LPJ0 | 14-113 | None |
| A0A7C1RIS1 | 4-109 | None |
| A1STL5 | 1-92 | None |
| A0A6J4LX60 | 145-239 | None |
| A0A643F8G6 | 1-91 | None |
| A0A523K8A2 | 1-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.