DPCstruct | MC6854
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 124 ± 14 aa |
| Standard deviation of domain lengths | 14.08 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P0JVH6 | 5-140 | RWKRIGYSWLAMKTWVKVWLFELNLVLFSAVFFINDPLGQYTLLSLIPTVTFLLVIAYYYGGLVRLLGLGHLIPWIPLLTYALLRLS… |
| A0A352C9G3 | 20-142 | SAGPFWVAWVAVLVGVNAIAPLFFWSTPQAKITAILFLAQGTLMALLTWASGYSRLLGLAHVGWFWLIPYLASAWSGAPLPTGLFAA… |
| A0A2N2RH75 | 3-124 | None |
| A0A2D9I6Q7 | 34-155 | None |
| A0A1M5LIB9 | 2-110 | None |
| A0A316GM94 | 15-128 | None |
| A0A355JXA8 | 3-104 | None |
| A0A355JVT6 | 17-132 | None |
| A0A5B9P7P3 | 4-136 | None |
| A0A2N3EFL1 | 28-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.