DPCstruct | MC6853
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 512 ± 71 aa |
| Standard deviation of domain lengths | 71.37 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 21.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0368 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5S9IRU5 | 16-533 | DIWAFKPKTHLYIAEIALQDAIDDGKVRIPYVDYETKEIIGYHDCTVPADILHALKNYPAQYRAGVMGPDAYPDLITGQQAIHPKYV… |
| A0A2E3AVF6 | 2-462 | GPDAYPDILTGQQAIHPQETNKWLKNIWDNSQTRIVKSSFFGQTIERKIDPGPEVKAFSLGYLTHAAGDMFGHTFVNNYSGGPFEVL… |
| A0A7V9QB10 | 28-596 | None |
| A0A4Q3U974 | 15-514 | None |
| A0A1V0DI96 | 17-607 | None |
| A0A1I0FFE9 | 1-403 | None |
| L8M262 | 40-560 | None |
| A0A366I3M5 | 1-397 | None |
| A0A4Q0I682 | 2-449 | None |
| A0A3M1ZR27 | 17-575 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.