DPCstruct | MC6852
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 133 ± 24 aa |
| Standard deviation of domain lengths | 23.89 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 92.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 54.36 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0228- PF14829 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M4E397 | 85-181 | TEEDLISGLRKEIEAGRLPPNVASGMEELFCNYKNAVLSSGAPRAAHTVLSNMSVAFDRMLLGVEHPFTFNPYHKAIREPFDYYQFV… |
| A0A833R4I9 | 11-139 | SLVELLLYIRRKVESGKLSPDFGHKLEELYYSYQNAILQSGNPNAHEVIRANMAVAFDRMLLDAEDPFILPPLHKAIREPFDYYKFG… |
| A0A7D5MRA9 | 4-138 | None |
| A0A287FIT9 | 31-147 | None |
| A0A1D6KA32 | 65-246 | None |
| A0A1D6GTA5 | 90-219 | None |
| A0A4Y7K7S7 | 100-220 | None |
| A0A4P1QRL1 | 11-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.