DPCstruct | MC6851
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 193 ± 23 aa |
| Standard deviation of domain lengths | 22.91 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 71.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08711 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0X1Q1 | 8-178 | LDYWRKIFSCAKTDIFELIDKAILVAAVDYSNEFNDRKDQILEMLYAPQLSPNNGYTNPKEEKNPHPDNHLESQIVGEVMKIKDILF… |
| A0A833QZ39 | 1-219 | MDPSEERLRQVLGTGFDIWSLIDTAIAVAVHDHPADLRLRREGIVQSLYALTPCRNCDPNRSNFANGHGPDSTRTNGDGSVVTLVNG… |
| A0A1U8EDV2 | 8-186 | None |
| A0A446JNV1 | 6-177 | None |
| A0A6P5G5D5 | 11-228 | None |
| A0A5A7QSJ7 | 1-190 | None |
| A0A843UU46 | 117-335 | None |
| A0A2U1M1F3 | 1-165 | None |
| A0A1D6QMM5 | 5-197 | None |
| A0A1D6MR49 | 14-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.