DPCstruct | MC6850
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 208 ± 17 aa |
| Standard deviation of domain lengths | 16.64 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 69.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11145 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q5QM74 | 481-665 | HAVAEMIKQRLLSVSYEFDIHLYRRVNSSRAWNVSRVPDRWRVSAEGVYDTKSGTLCMVGCRVINSSSDCQILVTVQLPALGGEDGT… |
| A0A833QTW6 | 1-233 | MYTTRARGTTIPSSPSLADQNHTTSNVGYTISYNNDVEISAEGIYYSTIGTLCLVGCRKPYFRHTQNGEILNSSARIDDRNLDCEFF… |
| A0A2J6MG03 | 162-362 | None |
| A0A6J1KRK5 | 21-223 | None |
| A0A0D9X0S5 | 618-855 | None |
| A0A445HTU3 | 158-359 | None |
| A0A834TIH2 | 487-698 | None |
| A0A2R6XFM0 | 1-217 | None |
| A0A6A6MTF2 | 116-301 | None |
| A0A834H479 | 443-630 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.