DPCstruct | MC685
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 93 ± 12 aa |
| Standard deviation of domain lengths | 12.43 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00285 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V1P5B9 | 1-84 | MQETATLTIGDKTIQLPVITGSEGEKAIDIRCLRKETGYITMDPGLANTGICESNITFMDGEKGILRYRGIPVEELAEHSTFSE |
| A0A1V5WNX4 | 1-78 | MDKATLTINNETFDLPVITGSMNEKAIDISELRKKSVYITLDPGYQNTGSCLSDITFIDGEKGVLKYRGIDIEVLAEK |
| A0A6A5L8G0 | 1-82 | None |
| U6KSW7 | 17-111 | None |
| A0A1A9VK80 | 65-149 | None |
| A0A1Q7HWJ6 | 12-118 | None |
| A0A021X413 | 1-83 | None |
| A0A377Z4Y9 | 3-81 | None |
| A0A837Q7T0 | 2-74 | None |
| A0A438DVS2 | 45-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.