DPCstruct | MC6845
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 86 ± 5 aa |
| Standard deviation of domain lengths | 5.14 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 60.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0090 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P5FDS2 | 85-170 | MSVFTMTCESAVQLRKSGEVTVRETTLKKLGSTHSKAGVADEHFEVVRFALLETIKEAVTDMWTEEMKNAWEEAFDQVAAAIKEEM |
| A0A833QBR1 | 1-96 | MKDDARDICTEILFKACEAATQLRRTGKVDLGANTTVKHLASVHFKAGIADVHFEVLKFALLETIKEAVPYMWSDELKEVWSESYDQ… |
| A0A199UUB7 | 214-299 | None |
| A0A7N2MES6 | 5-85 | None |
| A0A498JV32 | 52-131 | None |
| A0A1R3HY75 | 1050-1135 | None |
| A0A6P5Z809 | 271-355 | None |
| A0A328DDR8 | 29-122 | None |
| V7BIE5 | 5-82 | None |
| A0A0V0GGK5 | 1-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.