DPCstruct | MC6844
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 72 ± 3 aa |
| Standard deviation of domain lengths | 3.12 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 83.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 56.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4F2G5 | 757-828 | CGIKDEGIIVPPELGAENRTETNVLSSNFDSISYRRTPAEILRVLYDTGDEHKPGGFFPHGANGKIARDFLK |
| A0A2U1KT53 | 265-334 | GLKDEGLIVPVSLGADGRTTGNILSANASSLSYGRTPQEVLRILYQTGNEHVAGGFYPRGANGTIARKYL |
| A0A061DRH0 | 474-542 | None |
| A0A1U8MMT0 | 103-177 | None |
| A0A3Q7EPQ9 | 99-171 | None |
| A0A7J8ZYK5 | 151-225 | None |
| A0A6J5TGH0 | 189-254 | None |
| A0A1D6J6I3 | 29-98 | None |
| A0A1R3KYF7 | 1-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.