DPCstruct | MC6843
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 77 ± 4 aa |
| Standard deviation of domain lengths | 3.84 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 28.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G7TJM1 | 2-74 | SKTLIEFQDHHQDFLVWTVDEDGIVTESWPYQSDIWGGFKVTNLAELKTGSDVEYLWKGRTGWVKYPVRSVHP |
| A0A2V1IUC3 | 2-86 | KVTKITLEDKGQDVLMLFVDSNGVVIDAKPFQASVWAGAVVPIGVAGMVKVGAECPIHNPPHIVFGHLKYRVEAIETVEYDMSKN |
| A0A1H6NU77 | 17-87 | None |
| A0A840ELA8 | 27-100 | None |
| A0A6A2G0L3 | 127-201 | None |
| A0A1D7Y040 | 30-110 | None |
| A0A328ZIQ5 | 62-139 | None |
| X1T575 | 4-83 | None |
| A0A5S3W112 | 1-71 | None |
| A0A0F8Z6Z5 | 2-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.